PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0654s0015.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 253aa    MW: 28572.4 Da    PI: 7.5079
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0654s0015.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like90.31.8e-28196247152
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQk 52 
                          k+r++W+peLH+rFv+a++qLGGse+AtP++i+++m v+gLt+++vkSHLQ 
  Kalax.0654s0015.3.p 196 KQRRCWSPELHRRFVDALQQLGGSEVATPRQIRDIMRVEGLTNDEVKSHLQV 247
                          79*************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.76E-13194247IPR009057Homeodomain-like
PROSITE profilePS512949.517195252IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-23195248IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-23196249IPR006447Myb domain, plants
PfamPF002491.4E-5198248IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MDPIPTRDFL KFDDPPRRKL QRLADHVAGL EAERRKIEAF KRELPLCLDL LNDAVERFRE  60
ELRKCGDGGA ADCNCDKVEG PNSENDNDMK SWMSSVKLWN HHANDSPDFN STSSNVKSMI  120
EAEAVAENAG GAKMEIKGNS GDEVSLMKPV HAVARTVELE QLCGESARNL NRGKTLVHEL  180
KMQKKIQQAQ EQVGRKQRRC WSPELHRRFV DALQQLGGSE VATPRQIRDI MRVEGLTNDE  240
VKSHLQVMKT FR*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00629PBMTransfer from PK14402.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004288067.16e-55PREDICTED: probable transcription factor KAN4
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.12e-43G2-like family protein